Product Type
Condition
Binding
Collectible Attributes
Free Shipping
Seller Location
Seller Rating
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540437088ISBN 13: 9783540437086
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Peer-to-Peer (P2P) hat sich binnen kurzer Zeit zu einem der meistdiskutierten Phänomene in der jüngeren Geschichte der Informationstechnologie herausgebildet. Die millionenfach frequentierten Musiktauschbörsen wie etwa Napster haben dabei zu kontroversen Bewertungen von P2P geführt. Neben File-Sharing à la Napster zählen Instant Messaging, Collaboration/P2P Groupware, Grid bzw. Distributed Computing und Web Services zu den weiteren Facetten von P2P. Damit verbunden ist die Vorstellung leistungsfähiger Infrastrukturen für virtuelle Gemeinschaften, die Ressourcen teilen, Informationsaustauschprozesse beschleunigen und neuartige kollaborative Arbeitsumgebungen ermöglichen, ohne dass es einer zentralen Koordinationsinstanz bedarf. Die Autoren analysieren aus ökonomischer, technologischer und juristischer Perspektive Innovationspotentiale, offene Fragen und Risiken aller Anwendungsbereiche von P2P, stellen zentrale Konzepte, Geschäftsmodelle und professionelle Einsatzmöglichkeiten vor, diskutieren anhand aktueller Praxisbeispiele u.a. der Medienbranche Herausforderungen und skizzieren Technik-Initiativen wichtiger Marktspieler. 316 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540437800ISBN 13: 9783540437802
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -A morphism of algebraic varieties (over a field characteristic 0) is monomial if it can locally be represented in e'tale neighborhoods by a pure monomial mappings. The book gives proof that a dominant morphism from a nonsingular 3-fold X to a surface S can be monomialized by performing sequences of blowups of nonsingular subvarieties of X and S.The construction is very explicit and uses techniques from resolution of singularities. A research monograph in algebraic geometry, it addresses researchers and graduate students. 248 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540436871ISBN 13: 9783540436874
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Betriebliche Entscheidungsträger müssen in zunehmendem Maße komplexe Probleme lösen. Das vorliegende Buch bietet ein Training zur Verbesserung des Problemlösungsverhaltens an. Ein allgemeines Ablaufdiagramm wird schrittweise mit konkreten Übungen entwickelt, erprobt und auf komplexe ingenieur- und organisationswissenschaftliche Probleme angewandt. Heuristische Prinzipien, Pläne und Programme werden geordnet, klassifiziert und erweitert, so daß ein Repertoire von Handlungsmöglichkeiten zur Verfügung steht, die individuellen Bedürfnissen angepaßt werden können. Das Buch wird sowohl den Anforderungen der Ausbildung als auch der Berufspraxis gerecht und bietet einen Leitfaden zur effektiveren Planung und Durchführung der Arbeiten. 280 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440445ISBN 13: 9783540440444
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book is based on material presented at the international summer school on Applied Semantics that took place in Caminha, Portugal, in September 2000. We aim to present some recent developments in programming language research, both in semantic theory and in implementation, in a series of graduate-level lectures. The school was sponsored by the ESPRIT Working Group 26142 on Applied Semantics(APPSEM),whichoperatedbetweenApril1998andMarch2002.The purpose of this working group was to bring together leading reseachers, both in semantic theory and in implementation, with the speci c aim of improving the communication between theoreticians and practitioners. TheactivitiesofAPPSEMwerestructuredintonineinterdisciplinarythemes: A: Semantics for object-oriented programming B: Program structuring C: Integration of functional languages and proof assistants D: Veri cation methods E: Automatic program transformation F: Games, sequentiality, and abstract machines G: Types and type inference in programming H: Semantics-based optimization I: Domain theory and real number computation These themes were identi ed as promising for pro table interaction between semantic theory and practice, and were chosen to contribute to the following general topics: - description of existing programming language features; - design of new programming language features; - implementation and analysis of programming languages; - transformation and generation of programs; - veri cation of programs. The chapters in this volume give examples of recent developments covering a broad range of topics of interest to APPSEM. 552 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 354044145XISBN 13: 9783540441458
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Thisvolumecontainsthefullresearchpapersofthe2nd International Con- renceonMusicandArti cialIntelligence(ICMAI02),heldinSt. Cecilia sHall, Edinburgh,UK,12 14September2002. Theconferencewasjointlyorganizedby theFacultyofMusicandtheDivisionofInformatics,UniversityofEdinburgh. Eachofthepapersinthisvolumewasrefereedbyatleastthreereviewersfrom theProgramCommittee. AdditionalpaperswereacceptedasWork-in-Progress reports,publishedseparatelybytheDivisionofInformaticsoftheUnive rsity ofEdinburgh. Theconferenceprogramalsoincludedround-tablediscussions, electronicmusicconcerts,earlykeyboardintrumentdemonstrations,andvarious socialevents. Thefocusoftheconferencewasontheinterplaybetweenmusicaltheoryand practiceontheonehandandtechniquesandmethodsfromArti cialIntelligence, includingcomputationalcognitivemodelingofmusicalprocesses,ontheot her. Weareespeciallyinterestedinissuesofmusicalrepresentationandanalysis, associatedalgorithms,andtheevaluationofmusicalartefacts. MusicpresentsmanychallengesforAIandInformaticsingeneral. Whilethe analogieswithnaturallanguageandwithvisionareproductive,musicrequires novelsolutionstoitsownrepresentationalandalgorithmicproblems. Forthe musician,workinthisareacontributestowardsmusicologicalstudy,composition, performance,interactivesystems,andsoundsynthesis. Threedistinguishedscholarsinthearea,MiraBalaban,Jean-ClaudeRisset, andAntonioCamurri,agreedtogivetheinvitedkeynotes. Thesetalkscovered di erentfeaturesofmusicalexperienceanditsrelationtoArti cialIntelligence, namelymusicalconcepts,composition,andperformance. Morespeci cally,Jean- ClaudeRisset stopicwasMusicalCompositionandArti cialIntelligence:Some Precedents and Prospects,MiraBalaban swas Structure and Interpretation of Music Concepts Music from a Computational Perspective,andAntonio- murri swasComputationalModelsofExpressiveGesture. Thepapersintheconferencedealtwithawiderangeofaspectsofcurrent research,includingstructural,harmonic,andreductionalmusicanalysis,pattern representationanddiscoveryinbothmonophonicandpolyphonicmusic,musi c perceptionofmelodyandrhythm,therelationbetweenmusicandnaturallan- age,similarityandcategorization,musicandintonation,musicalexpressionand performance,soundprocessing,soundclassi cations,commercialapplications, andmusicontheweb. Acknowledgements. Theeditorsaregratefulforallthehelpofthosewho madethepublicationofthisvolumepossible,andespeciallyDarrellConklin, VI Organization PeterNelson,EmiliosCambouropoulos,AlisonPease,andMarkSteedman;also, JordanFleming,EwenMaclean,andRobertDow;andtheFacultyofMusicand theDivisionofInformatics,UniversityofEdinburghfor nancialsupport. July2002 ChristinaAnagnostopoulou MiguelFerrand AlanSmaill OrganizingCommittee AlanSmaill(Chair) ChristinaAnagnostopoulou(Co-chair) MiguelFerrand PeterNelson AlisonPease MarkSteedman ProgramCommittee JensArnspang(Alborg) GillianHayes(Edinburgh) MiraBalaban(Ben-Gurion) HenkjanHoning(Nijmegen) MartaOlivettiBelardinelli(Rome) JukkaLouhivuori(Jyvaskyla) RensBod(Amsterdam) TodMachover(MIT-MediaLab) CarolaBoehm(Glasgow) GuerinoMazzola(ZurichandVienna) AmilcarCardoso(Coimbra) StephenMcAdams(IRCAM) EmiliosCambouropoulos(Thessaloniki)EduardoMiranda(SONYCSL-Paris) ElaineChew(USC) PeterNelson(Edinburgh) DarrellConklin(ZymoGenetics) Fran coisPachet(SONYCSL-Paris) IanCross(Cambridge) StephenTravisPope(SantaBarbara) RogerDannenberg(CMU) AlanSmaill(Edinburgh) PeterDesain(Nijmegen) MarkSteedman(Edinburgh) AnastasiaGeorgaki(Athens) DavidTemperley(Rochester) InvitedSpeakers MiraBalaban(Ben-GurionUniversity,Israel) AntonioCamurri(UniversityofGenoa,Italy) Jean-ClaudeRisset(LaboratoiredeM echaniqueetd Acoustique,France) TableofContents InvitedTalks StructureandInterpretationofMusicConcepts:Musicfroma ComputationalPerspective. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 MiraBalaban ExpressiveGesture. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 AntonioCamurri RegularContributions AGeneralParsingModel 220 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440747ISBN 13: 9783540440741
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The International Conferences on Arti cial Neural Networks, ICANN, have been held annually since 1991 and over the years have become the major European meeting in neural networks. This proceedings volume contains all the papers presented at ICANN 2002, the 12th ICANN conference, held in August 28- 30, 2002 at the Escuela T ecnica Superior de Inform atica of the Universidad Aut onoma de Madrid and organized by its Neural Networks group. ICANN 2002 received a very high number of contributions, more than 450. Almost all papers were revised by three independent reviewers, selected among the more than 240 serving at this year's ICANN, and 221 papers were nally selected for publication in these proceedings (due to space considerations, quite a few good contributions had to be left out). I would like to thank the Program Committee and all the reviewers for the great collective e ort and for helping us to have a high quality conference. 1444 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 354043769XISBN 13: 9783540437697
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The book reviews the present status of understanding the nature of the most luminous objects in the Universe, connected with supermassive black holes and supermassive stars, clusters of galaxies and ultraluminous galaxies, sources of gamma-ray bursts and relativistic jets. Leading experts give overviews of essential physical mechanisms involved, discuss formation and evolution of these objects as well as prospects for their use in cosmology, as probes of the intergalactic medium at high redshifts and as a tool to study the end of dark ages. The theoretical models are complemented by new exciting results from orbital and ground-based observatories such as Chandra, XMM-Newton, HST, SDSS, VLT, Keck, and many others. 636 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440666ISBN 13: 9783540440666
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book presents refereed and revised papers presented at GREC 2001, the 4th IAPR International Workshop on Graphics Recognition, which took place in Kingston, Ontario, Canada in September 2001. Graphics recognition is a branch of document image analysis that focuses on the recognition of two-dimensional notations such as engineering drawings, maps, mathematical notation, music notation, tables, and chemical structure diagrams. Due to the growing demand for both o -line and on-line document recognition systems, the eld of graphics recognition has an excitingand promisingfuture. The GREC workshops provide an opportunity for researchers at all levels of experience to share insights into graphics recognition methods. The workshops enjoy strongparticipation from researchers in both industry and academia. They are sponsored by IAPR TC-10, the Technical Committee on Graphics Recog- tion within the International Association for Pattern Recognition. Edited v- umes from the previous three workshops in this series are available as Lecture Notes in Computer Science, Vols. 1072, 1389, and 1941. After the GREC 2001 workshop, authors were invited to submit enhanced versions of their papers for review. Every paper was evaluated by three reviewers. We are grateful to both authors and reviewers for their careful work during this review process. Many of the papers that appear in this volume were thoroughly revised and improved, in response to reviewers' suggestions. 388 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441913ISBN 13: 9783540441915
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book deals with experience management in the context of real-world applicability and realistic applications. A particular focus is given by the requirements that arise in complex problem solving and by the fact that modern experience management must be implemented as Internet-based applications. Concrete application areas that are discussed in this book are electronic commerce, diagnosis of complex technical equipment, and electronic design reuse. This book explores how experience management can be supported by information technology, especially by techniques that stem from knowledge-based systems, case-based reasoning, machine learning, and process modeling. It surveys different methods in a unified terminology and investigates them with respect to application requirements. Further, the process of application development and maintenance is highlighted, pointing out successful practically proven ways for obtaining and operating experience management applications. 420 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540656324ISBN 13: 9783540656326
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Included here is a discussion of the pathophysiological aspects and risks of laparoscopic staging (such as trocar metastases) on the basis of international experience. 200 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540434941ISBN 13: 9783540434948
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The book gives the reader the basis for understanding the way numerical schemes achieve accurate and stable simulations of physical phenomena. It is based on the finite-difference method and simple problems that allow also the analytic solutions to be worked out. ODEs as well as hyperbolic, parabolic and elliptic types are treated. The book builds on simple model equations and, pedagogically, on a host of problems given together with their solutions. 208 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441581ISBN 13: 9783540441588
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume of the Lecture Notes in Computer Science series provides a c- prehensive, state-of-the-art survey of recent advances in string processing and information retrieval. It includes invited and research papers presented at the 9th International Symposium on String Processing and Information Retrieval, SPIRE2002, held in Lisbon, Portugal. SPIREhas its origins in the South Am- ican Workshop on String Processing which was rst held in Belo Horizonte, Brazil, in 1993. Starting in 1998, the focus of the workshop was broadened to include the area of information retrieval due to its increasing relevance and its inter-relationship with the area of string processing. The call for papers for SPIRE2002 resulted in the submission of 54 papers from researchers around the world. Of these, 19 were selected for inclusion in the program (an acceptance rate of 35%). In addition, the Program Committee decided to accept six other papers, considered as describing interesting ongoing research, in the form of short papers. The authors of these 25 papers came from 18 di erent countries (Argentina, Australia, Brazil, Canada, Czech Republic, Chile, Colombia, Finland, France, Germany, Japan, Italy, Mexico, Saudi Arabia, Switzerland, Spain, United Kingdom, and USA). 356 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540437363ISBN 13: 9783540437369
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume contains lectures given at the Saint-Flour Summer School of Probability Theory during the period 8th-24th July, 1999. We thank the authors for all the hard work they accomplished. Their lectures are a work of reference in their domain. The School brought together 85 participants, 31 of whom gave a lecture concerning their research work. At the end of this volume you will find the list of participants and their papers. Finally, to facilitate research concerning previous schools we give here the number of the volume of 'Lecture Notes' where they can be found: Lecture Notes in Mathematics 1975: n ° 539- 1971: n ° 307- 1973: n ° 390- 1974: n ° 480- 1979: n ° 876- 1976: n ° 598- 1977: n ° 678- 1978: n ° 774- 1980: n ° 929- 1981: n ° 976- 1982: n ° 1097- 1983: n ° 1117- 1988: n ° 1427- 1984: n ° 1180- 1985-1986 et 1987: n ° 1362- 1989: n ° 1464- 1990: n ° 1527- 1991: n ° 1541- 1992: n ° 1581- 1993: n ° 1608- 1994: n ° 1648- 1995: n ° 1690- 1996: n ° 1665- 1997: n ° 1717- 1998: n ° 1738- Lecture Notes in Statistics 1971: n ° 307- Table of Contents Part I Erwin Bolthausen: Large Deviations and Interacting Random Walks 1 On the construction of the three-dimensional polymer measure. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 2 Self-attracting random walks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 3 One-dimensional pinning-depinning transitions. . . . . . . . . . . 105 References. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 484 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440372ISBN 13: 9783540440376
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -We are pleased to present the proceedings of the 13th European Conference on Machine Learning (LNAI 2430) and the 6th European Conference on Principles and Practice of Knowledge Discovery in Databases (LNAI 2431). These two c- ferences were colocated in Helsinki, Finland during August 19 23, 2002. ECML and PKDD were held together for the second year in a row, following the success of the colocation in Freiburg in 2001. Machine learning and knowledge discovery are two highly related elds and ECML/PKDD is a unique forum to foster their collaboration. The bene t of colocation to both the machine learning and data mining communities is most clearly displayed in the common workshop, tutorial, and invited speaker program. Altogether six workshops and six tutorials were or- nized on Monday and Tuesday. As invited speakers we had the pleasure to have Erkki Oja (Helsinki Univ. of Technology), Dan Roth (Univ. of Illinois, Urbana- Champaign), Bernhard Sch olkopf (Max Planck Inst. for Biological Cybernetics, T ubingen), and Padhraic Smyth (Univ. of California, Irvine). The main events ran from Tuesday until Friday, comprising 41 ECML te- nical papers and 39 PKDD papers. In total, 218 manuscripts were submitted to these two conferences: 95 to ECML, 70 to PKDD, and 53 as joint submissions. All papers were assigned at least three reviewers from our international program committees. Out of the 80 accepted papers 31 were rst accepted conditi- ally; the revised manuscripts were accepted only after the conditions set by the reviewers had been met. 544 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441654ISBN 13: 9783540441656
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume contains the proceedings of FTRTFT 2002, the International S- posium on Formal Techniques in Real-Time and Fault-Tolerant Systems, held at the University of Oldenburg, Germany, 9-12 September 2002. This sym- sium was the seventh in a series of FTRTFT symposia devoted to problems and solutions in safe system design. The previous symposia took place in Warwick 1990, Nijmegen 1992, Lub eck 1994, Uppsala 1996, Lyngby 1998, and Pune 2000. Proceedings of these symposia were published as volumes 331, 571, 863, 1135, 1486, and 1926 in the LNCS series by Springer-Verlag. This year the sym- sium was co-sponsored by IFIP Working Group 2.2 on Formal Description of Programming Concepts. The symposium presented advances in the development and use of formal techniques in the design of real-time, hybrid, fault-tolerant embedded systems, covering all stages from requirements analysis to hardware and/or software - plementation. Particular emphasis was placed on UML-based development of real-time systems. Through invited presentations, links between the dependable systems and formal methods research communities were strengthened. With the increasing use of such formal techniques in industrial settings, the conference aimed at stimulating cross-fertilization between challenges in industrial usages of formal methods and advanced research. Inresponsetothecallforpapers,39submissionswerereceived.Eachsubm- sion was reviewed by four program committee members assisted by additional referees. At the end of the reviewing process, the program committee accepted 17 papers for presentation at the symposium. 472 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 354043951XISBN 13: 9783540439516
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The present book is devoted to a study of relative Prüfer rings and Manis valuations, with an eye to application in real and p-adic geometry. If one wants to expand on the usual algebraic geometry over a non-algebraically closed base field, e.g. a real closed field or p-adically closed field, one typically meets lots of valuation domains. Usually they are not discrete and hence not noetherian. Thus, for a further develomemt of real algebraic and real analytic geometry in particular, and certainly also rigid analytic and p-adic geometry, new chapters of commutative algebra are needed, often of a non-noetherian nature. The present volume presents one such chapter. 280 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540435883ISBN 13: 9783540435884
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The World Court Digest continues the Fontes Iuris Gentium, a series that presents the decisions of the Permanent Court of International Justice, up to 1990. The new volume covers the period from 1996 to 2000. All important pronouncements of the Court in its judgments and advisory opinions, are systematically arranged under specific topics taken from substantive and procedural international law. The World Court Digest provides reliable access to the decisions of the most significant international judicial organ on questions as important as the aerial incident at Lockerbie, the crimes of genocide in Bosnia and Herzegovina, as well as the use of nuclear weapons and the use of force in the Yugoslavian context. 772 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540677712ISBN 13: 9783540677710
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Dieses verständliche Handbuch gibt einen fundierten Überblick über das Capability Maturity Model (CMM) des Software Engineering Instituts (SEI).Das CMM ist ein Modell, das häufig bei der Software-Prozessverbesserung verwendet wird. Es ist stark abstrahiert, um eine Anwendung bei den meisten Software-Entwicklungsprozessen zu ermöglichen. Dieses Handbuch macht das CMM all jenen zugänglich, die sein Konzept untersuchen und verstehen möchten. Piktogramme und verständliche Erklärungen ermöglichen dem Leser die effiziente Umsetzung des CMM bei den Schlüsselprozessbereichen. 236 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 354043531XISBN 13: 9783540435310
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -It is a pleasure to see this book in print. It represents work on an immense importance to assisted human conception. Numerous books have presented virtually every aspect of follicular growth, fertilization, male and female sterility and implantation.This is among the rare books dedicated to pr- nancy,birth and infant growth. Since the introduction of IVF,it has been clear that various problems could be associated with pregnancy after assisted human conception. The first clinical IVF pregnancy after the transfer of a 5-day blastocyst turned out to be ectopic,and this subjecthas neverbeen farfrom debates on the safety of assi- ed human conception ever since. Ectopic and heterotopic pregnancies were two factors stressed in early days of wor- wide IVF,and multiple pregnancies emerged as perhaps as an even more serious problem as high degrees of ovarian sti- lation began to be practised in some clinics. These chapters add the experience of the author, working in a large German IVF team,to discussions on these topics in this book. 168 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540438289ISBN 13: 9783540438281
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Die Abhandlung beleuchtet das für Europäer immer noch exotische Zeitverständnis der Japaner. Zur Vermittlung der geschichtlichen und soziologischen Voraussetzungen stellt der Autor die Werke der führenden japanischen Philosophen sowie Rechtswissenschaftler vor. Die Analyse führt zu dem Ergebnis, dass der Zeitbegriff im Bewußtsein der Japaner seit Beginn der landesweiten Modernisierung janusköpfig gestaltet ist: Einerseits wurde versucht, die Zukunftsorientiertheit der Japaner durch den totalen Bruch mit ihrer Vergangenheit herbeizuführen. Andererseits wurde jedoch zugleich ihre Sehnsucht nach dem Japanisch-Kaiserlichen als Symbol ihrer gemeinsamen Vergangenheit gestärkt. Diese Zwiespältigkeit trat nach Ansicht des Autors immer dann offen zutage, wenn die Beschleunigung der gesellschaftlichen Integration in Japan dringend geboten war. 148 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540437207ISBN 13: 9783540437208
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Unternehmensnetzwerke spielen eine zunehmend wichtige Rolle in allen Bereichen der Industrie und sind deshalb ein brandaktueller Gegenstand wissenschaftlicher Forschung. Sie werden auf allen Ebenen der Wertschöpfungskette gebildet, z. B. um Produktionseinheiten zu verbinden, Produkte zu entwickeln oder um Veränderungen in einer Branche voranzutreiben. So vielfältig wie die Einsatzbereiche von Netzwerken sind auch die Aspekte, die zur erfolgreichen Gestaltung eines solchen Netzwerks zu bedenken sind. Namhafte Experten aus Industrie und Forschung, wie Professor Warnecke, Fraunhofer-Gesellschaft, 'Die Fraktale Fabrik', oder Professor Milberg, München, beleuchten in dieser Festschrift für Professor Eversheim in gut verständlicher Weise wie der Netzwerkgedanke ihr Arbeitsfeld beeinflusst. Sie zeigen die Chancen dieses Konzepts auf und erklären die Möglichkeiten, die das vernetzte Arbeiten bietet. Aber auch Risiken und Einschränkungen des Netzwerkgedankens werden erwähnt. Mit diesem Werk richten sich die Autoren an Leser, die einen breiten und vielfältigen Überblick über die Thematik und Anregungen für ihr eigenes Arbeitsumfeld suchen, die Wertschöpfungsketten in Netzwerken gestalten wollen oder Kooperationen mit anderen Unternehmen planen. 360 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540435417ISBN 13: 9783540435419
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Many important observational clues about our understanding of how stars and planets form in the interior of molecular clouds have been amassed using recent technological developments. ESO's very large telescope promises to be a major step forward in the investigation of stellar nurseries and infant stars. This volume collects papers from the leaders in this very timely field of astrophysical research. It presents theoretical and a host of observational results and many papers show the plans for future observations.Many important observational clues about our understanding of how stars and planets form in the interior of molecular clouds have been amassed using recent technological developments. ESO's Very Large Telescope promises to be a major step forward in the investigation of stellar nurseries and infant stars. This volume collects papers from the leaders in this very timely field of astrophysical research. It presents theoretical and a host of observational results and many papers show the plans for future observations. 544 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441840ISBN 13: 9783540441847
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The Arti cial Intelligence and Cognitive Science Conference has taken place annually since 1988. It provides a forum for the exchange of ideas and the p- sentation of results relating to work conducted both in Ireland and worldwide. The conference spans a large number of elds including case-based reas- ing, cognitive modeling, constraint processing, data mining, evolutionary c- putation, intelligent agents, intelligent information retrieval, knowledge rep- sentation and reasoning, learning, natural language processing, neural networks, perception and planning, robotics, and scheduling. AICS 2002 was the thirteenth conference in the series and took place at U- versityofLimerickon12 13September.Inadditiontothe16regularpapersand 17 concise papers accepted for presentation, we were delighted to welcome two prestigious keynote speakers both tting in with the conference theme Towards Bio-inspired Computing . They were David Goldberg of University of Illinois at Urbana-Champaign, and Dario Floreano of the Swiss Federal Institute of Te- nology. I would like to take this opportunity to thank our sponsors QAD Ireland and University of Limerick, as well as all those who were involved in the organisation of the conference including the Co-chairs, Programme Committee members, and Conference Administrators. June 2002 Richard F. E. Sutcli e Organisation AICS 2002 was organized by the Department of Computer Science and Inf- mation Systems, University of Limerick, in association with the Arti cial Int- ligence Association of Ireland. 264 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441271ISBN 13: 9783540441274
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The AIMSA conference series was rst conceived in 1984 as a gathering of AI researchersandstudentsfromEasternandCentralEurope.Sincethenthecon- rence has followed a biennial schedule of meetings in Bulgaria, attracting parti- pantsfromawidergeographicalarea.Today,20yearson,AIMSAisathoroughly international conference, with contributions from most European countries and some from as far a eld as the United States, Mexico and Brazil. The AIMSA organizers are delighted to present you with another exciting program,coveringmostareasofArti cialIntelligence.Inkeepingwithitsm- sion to inform the research community and excite the commercial sector, AIMSA presents this year two invited contributions from world-leading European rese- chersworkingoncutting-edgeAIresearch:Prof.CaroleGoble,ontheSemantic Web,andProf.DavidHouse,onintegratedspeechandgesturalsynthesis.In addition, we present 26 contributions on topics covering almost all aspects of AIandbringingtogetherbasicandappliedresearch.Oneofthese,byMilos Kova cevi c and his colleagues on Recognition of Common Areas in a Web Page Using a Visualisation Approach was judged by reviewers to be the best s- mitted paper, and duly received the accolade of Best Paper of the Conference, with a special slot devoted to it in the program. As Chair of the Program Committee, I am extremely grateful to those who so generously agreed to apply their expertise and valuable time to reviewing papers for the conference, and for their dedication in getting the best possible job done in what turned out to be a very short period of time. 296 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441239ISBN 13: 9783540441236
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Within the last few years Data Warehousing and Knowledge Discovery technology has established itself as a key technology for enterprises that wish to improve the quality of the results obtained from data analysis, decision support, and the automatic extraction of knowledge from data. The Fourth International Conference on Data Warehousing and Knowledge Discovery (DaWaK 2002) continues a series of successful conferences dedicated to this topic. Its main objective is to bring together researchers and practitioners to discuss research issues and experience in developing and deploying data warehousing and knowledge discovery systems, applications, and solutions. The conference focuses on the logical and physical design of data warehousing and knowledge discovery systems. The scope of the papers covers the most recent and relevant topics in the areas of association rules, clustering, Web mining, security, data mining techniques, data cleansing, applications, data warehouse design and maintenance, and OLAP. These proceedings contain the technical papers selected for presentation at the conference. We received more than 100 papers from over 20 countries, and the program committee finally selected 32 papers. The conference program included one invited talk: 'Text Mining Applications of a Shallow Parser' by Walter Daelemans, Univer- ty of Antwerp, Belgium. We would like to thank the DEXA 2002 Workshop General Chair (Roland Wagner) th and the organizing committee of the 13 International Conference on Database and Expert Systems Applications (DEXA 2002) for their support and their cooperation. 360 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441476ISBN 13: 9783540441472
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume contains the papers presented at the 6th International Workshop on Randomization and Approximation Techniques in Computer Science (RAN- DOM 2002), which took place at Harvard University, Cambridge, Massachusetts, from September 13 15, 2002. RANDOM 2002 was concerned with applications of randomness to computational and combinatorial problems, and was the sixth workshop in the series following Bologna, Barcelona, Berkeley, Geneva, and B- keley again. The volume contains 21 contributed papers, selected by the program c- mittee from 48 submissions received in response to the call for papers. We thank all of the authors who submitted papers, our invited speakers, the members of the program committee: Dimitris Achlioptas, Microsoft Research Martin Dyer, U. of Leeds Uriel Feige, Weizmann Institute Russell Impagliazzo, UC San Diego Sampath Kannan, U. of Pennsylvania David Karger, MIT Nati Linial, Hebrew U. Rafail Ostrovsky, Telcordia Technologies Paul Spirakis, U. of Patras and CTI Angelika Steger, TU Munich R udiger Urbanke, Swiss Federal Inst. of Tech. Salil Vadhan, Harvard U., chair, and the external reviewers: N. Alon, R. Alur, A. Ambainis, T. Batu, J. Feig- baum, S. Gerke, Y. Gertner, A. Goerdt, L. Goldberg, J. Hastad, C. Iliopoulos, Y. Ishai, V. Kabanets, S. Khot, L. Kirousis, S. Kontogiannis, M. Krivelevich, M. Mavronicolas, A. McGregor, F. McSherry, D. van Melkebeek, M. Molloy, E. Mossel, S. Nikoletseas, R. Raz, D. Ron, P. Tetali, L. Trevisan, E. Vigoda, J. Watrous, and P. Winkler. 292 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440887ISBN 13: 9783540440888
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -For the rst time four workshops have been held in conjunction with the 8th Object-Oriented Information Systems conference, OOIS 2002, to encourage - teraction between researchers and practitioners. Workshop topics are, of course, inline with the conference's scienti c scope and provide a forum for groups of researchers and practitioners to meet together more closely and to exchange opinions and advanced ideas, and to share preliminary results on focused issues in an atmosphere that fosters interaction and problem solving. The conference hosted four one-day workshops. The four selected workshops were fully in the spirit of a workshop session hosted by a main conference. Indeed, OOIS deals with all the topics related to the use of object-oriented techniques for the development of information systems. The four workshops are very speci c and contribute to enlarging the spectrum of the more general topics treated in the main conference. The rst workshop focused on a very speci c and key c- cept of object-oriented development, the specialization/generalization hierarchy. The second one explored the use of 'non-traditional' approaches (at the edge of object-oriented techniques, such as aspects, AI, etc.) to improve reuse. The third workshop dealt with optimization in Web-based information systems. And nally the fourth workshop investigated issues related to model-driven software development. 336 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540441107ISBN 13: 9783540441106
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware 188 pp. Englisch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540435352ISBN 13: 9783540435358
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Diese Studie zielt darauf ab, wirtschaftliche Globalisierung und deren Auswirkungen auf den Arbeitsmarkt am Beispiel der deutschen, japanischen und amerikanischen Automobilindustrie zu konkretisieren. Drei Fragen stehen im Mittelpunkt: Inwieweit sind Entwicklungs- und Schwellenländer selbst in der relativ technologie- und humankapitalintensiven Automobilindustrie zu international wettbewerbsfähigen Anbietern herangereift Finden sich aus einfachen Handelsmodellen abgeleitete Erwartungen bestätigt, dass das Vordringen von Niedrigeinkommensländern auf den Weltmärkten mit negativen Einkommens- und Beschäftigungseffekten für gering qualifizierte Arbeitskräfte in Hocheinkommensländern einhergeht In welcher Weise haben sich die traditionellen Automobilproduzenten an den zunehmenden Wettbewerb von unten angepasst, und welcher Zusammenhang besteht zwischen der Art und Intensität des Strukturwandels und den globalisierungsbedingten Arbeitsmarkteffekten in diesem Sektor 134 pp. Deutsch.
Published by Springer Berlin Heidelberg Aug 2002, 2002
ISBN 10: 3540440798ISBN 13: 9783540440796
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, Germany
Book Print on Demand
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The fthFinancialCryptographyconferencewasheldFebruary19 22,2001. Afterhalfadecade,wemovedbeyondourAnguillanoriginstoGrandCayman, BWI. Thevenuechangedbutthefocusoftheprogramremainedtopresentthe bestresearchinsecuringelectronic nancialtransactionsandelectronicc- merce. Asinthepastfewyears,mostofthecontributedpapersfocusedonthe technicalcryptographicandsecurityaspectsof nancialcryptography,whilethe nancialaspectsarere ectedprimarilyininvitedtalksandpanels. (Andinthe informaldiscussion. )Thisyear,inadditiontothesubmittedpapers,wehada provocativeinvitedtalkbyRichardRahnonmoneylaunderingaswellaspanels ondigitalrightsmanagementandthebusinessofelectronicvoting. Therewas alsoarumpsession,chairedbyRebeccaWright. Thereweremanyinterestingandmanytechnicallystrongsubmissions. I thanktheprogramcommittee(listedonthenextpage)fortheirhelpinthe di culttaskofchoosingthosepapersthatmadethestrongestcontributionto theconference. WehadadditionalreviewinghelpfromOlivierBaudron,Paul Fahn,JuanGaray,MarkusJakobsson,GuenterKarjoth,PhongNguyen,David Pointcheval,ThomasPornin,SholomRosen,DawnSong,SusanneWetzel,and RebeccaWright. (MyapologiesifIhaveoverlookedanyone. )Iwouldalsoliketo thankGeorgeDavida,theelectronicsubmissionschair,andhisstudent,Dawn MarieGibson,forsettingupandrunningthesubmissionsprocessattheUniv- sityofWisconsin. AnextrabigthankyoutoYairFrankel,whowasalwaysthere withhisexperienceandadvicethatgreatlyimprovedthejobIdidasprog ram chair,aswellasmakingitmoreenjoyable. MattFranklinalsoprovidedvaluable advice. Thankstoallthepeoplewhosubmittedpapers,withoutwhichthere wouldbenoprogram. Authorsweregiventheopportunitytorevisetheirpapers followingtheconference. Thesewerecollectedwithoutfurtherreviewandare includedinthisvolume. ThankstogeneralchairStuartHaberfordoingmanythingsthatnoneofthe attendeesnoticedbecausehedidthemsonicely. HewasablyassistedbyHinde tenBerge. ThankstoHarrisMcCoyforhandlinglocalarrangementsandJason CronkformaintainingtheWebsite. ThankstotheIFCAdirectorsforkeeping FCthriving,toAdamShostackforvenuearrangements,andtoBarbFox,the sponsorshipchair. Thankstoour nancialsponsors,whoarelistedonthenext page. SpecialthankstoRayHirschfeldwhoseadvicetomeandtotheothersm- tionedherehasbeeninvaluable. Thanks nallytoattendeeswithoutwhomthere wouldbenoconference. March2001 PaulSyverson VI Preface ProgramCommittee MattBlaze,AT&TLabs-Research YairFrankel,Ecash MattFranklin,UCDavis DavidKravitz,WaveSystemsCorp. ArjenLenstra,Citicorp PhilipMacKenzie,LucentBellLabs AviRubin,AT&TLabs-Research JacquesStern,EcoleNormaleSup erieure KazueSako,NEC StuartStubblebine,CertCo PaulSyverson(Chair),NavalResearchLab WinTreese,OpenMarket,Inc. DougTygar,UCBerkeley MichaelWaidner,IBMZurichResearchLab MotiYung,CertCo GeneralChair StuartHaber,Intertrust SponsorshipChair BarbFox,Microsoft FinancialCryptography2001wasorganizedbytheInternationalFinancialCr- tographyAssociation(IFCA),andwassponsoredbyBibitInternetPayments, CertCo,Certicom,HushCommunications,IBM,InterTrustSTARLab,- crosoft,nCipher,RSASecurity,andZero-KnowledgeSystems. TableofContents ManagingPaymentTransactionCosts AmortizedE-Cash . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 MosesLiskov,SilvioMicali O ineMicropaymentswithoutTrustedHardware. . . . . . . . . . . . . . . . . . . . . . 21 MattBlaze,JohnIoannidis,AngelosD. Keromytis Panel(I) ThePracticalProblemsofImplementingMicroMint. . . . . . . . . . . . . . . . . . . . 41 NickovanSomeren ProtectingDigitalRights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 YairFrankel AspectsofDigitalRightsManagementandtheUseofHardwareSecurity Devices. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 DavidW. Kravitz ASolutiontotheNapsterPhenomenon:WhyValueCannotBeCreated AbsenttheTransferofSubjectiveData. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 ScottMoskowitz GoldenTimesforDigitalRightsMan 396 pp. Englisch.